PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.8G081800.5.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family ZF-HD
Protein Properties Length: 378aa    MW: 39055 Da    PI: 8.1418
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.8G081800.5.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer103.91.1e-3285140359
         ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                          v+Y+eClkNhAa++Gg+a+DGCgEfmps geeg+ +alkC+ACgCHRnFHR+ev++
  Sevir.8G081800.5.p  85 VVKYRECLKNHAAAIGGNATDGCGEFMPS-GEEGSLEALKCSACGCHRNFHRKEVDD 140
                         689*************************9.999********************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047701.4E-2986138IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257749.0E-2487138IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.0E-3087138IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.73588137IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466891.11E-20233302IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.8E-31233304IPR009057Homeodomain-like
TIGRFAMsTIGR015651.6E-26244300IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 378 aa     Download sequence    Send to blast
MDLSGTQGEL AIPMHANVVS PYGGGSAGGH VLQLHHVEQH GNNNNGQSPA LPPSPPAAAA  60
AEEMEGSAKK RGAGGGAGIG GGATVVKYRE CLKNHAAAIG GNATDGCGEF MPSGEEGSLE  120
ALKCSACGCH RNFHRKEVDD DDDDAMYAAA GHGHRAARRL LAPAMPHHHN KGGGGGLLVS  180
AADPYGAYAA ARALPPPPGH GHPHHHQYVM PLTMMHNSES DDMDISGGSG AARGGGSGGS  240
SSSRKRFRTK FTPEQKARML EFAERVGWRL QKLDDAMVQA FCQDIGVKRR VLKVWMHNNK  300
HNLATKRLEA ASPPQEQQAM AAAAAALPSP PPSAPLMPLQ MMPPGIMPPP PPPAQAAGPS  360
CHRGGPGSPP SPPLKLE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh5_A3e-242443021775ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1354601e-168AC135460.3 Oryza sativa Japonica Group cultivar Nipponbare chromosome 11 clone OSJNBb0091I11, complete sequence.
GenBankAK2877141e-168AK287714.1 Oryza sativa Japonica Group cDNA, clone: J065133O18, full insert sequence.
GenBankAP0149671e-168AP014967.1 Oryza sativa Japonica Group DNA, chromosome 11, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014661088.10.0PREDICTED: zinc-finger homeodomain protein 4-like isoform X1
SwissprotQ53N872e-98ZHD4_ORYSJ; Zinc-finger homeodomain protein 4
TrEMBLK7TRK31e-145K7TRK3_MAIZE; Putative homeobox DNA-binding domain superfamily protein
TrEMBLK7TV961e-146K7TV96_MAIZE; Putative homeobox DNA-binding domain superfamily protein isoform 1
STRINGGRMZM2G068330_P021e-145(Zea mays)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14440.21e-28homeobox protein 31